Lineage for d4l5fl2 (4l5f L:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760713Domain d4l5fl2: 4l5f L:108-213 [229668]
    Other proteins in same PDB: d4l5fe_, d4l5fh_
    automated match to d1g9ml2

Details for d4l5fl2

PDB Entry: 4l5f (more details), 2.45 Å

PDB Description: crystal structure of denv1-e106 fab bound to denv-1 envelope protein diii
PDB Compounds: (L:) Light chain of E106 antibody (kappa)

SCOPe Domain Sequences for d4l5fl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l5fl2 b.1.1.0 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d4l5fl2:

Click to download the PDB-style file with coordinates for d4l5fl2.
(The format of our PDB-style files is described here.)

Timeline for d4l5fl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l5fl1