SCOPe 2.08: Domain d4l5fl2: 4l5f L:108-213

Lineage for d4l5fl2 (4l5f L:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4l5fl2: 4l5f L:108-213 [229668]
   Other proteins in same PDB: d4l5fe_, d4l5fh_
   automated match to d1g9ml2

Details for d4l5fl2

PDB Entry: 4l5f, 2.45 Å

PDB Description: crystal structure of denv1-e106 fab bound to denv-1 envelope protein diii

PDB Compounds: (L:) Light chain of E106 antibody (kappa)

SCOPe Domain Sequences for d4l5fl2:

Sequence; same for both SEQRES and ATOM records:

>d4l5fl2 b.1.1.0 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4l5fl2:

• d4l5fl2 first appeared in SCOPe 2.03
  
• d4l5fl2 appears in SCOPe 2.07