SCOPe 2.07: Domain d4larl_: 4lar L:

Lineage for d4larl_ (4lar L:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d4larl_: 4lar L: [229664]
   Other proteins in same PDB: d4larh_
   automated match to d2dtgd1
   complexed with 1we

Details for d4larl_

PDB Entry: 4lar, 2.38 Å

PDB Description: crystal structure of a therapeutic single chain antibody in complex with amphetamine

PDB Compounds: (L:) Single light chain Variable fragment

SCOPe Domain Sequences for d4larl_:

Sequence; same for both SEQRES and ATOM records:

>d4larl_ b.1.1.0 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sggggsqivltqspaimsaspgekvtltcsasssvssshlywyqqkpgsspklwiystsn
lasgvparfsgsgsgtsysltissmeaedaasyfchqwssfpftfgsgtkleikr

Timeline for d4larl_:

• d4larl_ first appeared in SCOPe 2.03
  
• d4larl_ appears in SCOPe 2.06
  
• d4larl_ does not appear in SCOPe 2.08