Lineage for d4lz5a_ (4lz5 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1391676Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1391677Protein automated matches [190039] (57 species)
    not a true protein
  7. 1391854Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (69 PDB entries)
  8. 1391894Domain d4lz5a_: 4lz5 A: [229654]
    automated match to d4lz5b_
    complexed with 1yv, glu, zn

Details for d4lz5a_

PDB Entry: 4lz5 (more details), 1.5 Å

PDB Description: crystal structures of glur2 ligand-binding-domain in complex with glutamate and positive allosteric modulators
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d4lz5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lz5a_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOPe Domain Coordinates for d4lz5a_:

Click to download the PDB-style file with coordinates for d4lz5a_.
(The format of our PDB-style files is described here.)

Timeline for d4lz5a_: