Lineage for d4lt7a_ (4lt7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773134Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (10 PDB entries)
  8. 2773150Domain d4lt7a_: 4lt7 A: [229647]
    automated match to d2chda_
    complexed with ca

Details for d4lt7a_

PDB Entry: 4lt7 (more details), 2.5 Å

PDB Description: crystal structure of the c2a domain of rabphilin-3a in complex with a calcium
PDB Compounds: (A:) rabphilin-3a

SCOPe Domain Sequences for d4lt7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lt7a_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklrtktl
rntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkanqrkn
fniclerv

SCOPe Domain Coordinates for d4lt7a_:

Click to download the PDB-style file with coordinates for d4lt7a_.
(The format of our PDB-style files is described here.)

Timeline for d4lt7a_: