SCOPe 2.08: Domain d4luva1: 4luv A:1-120

Lineage for d4luva1 (4luv A:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein automated matches [190206] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186959] (27 PDB entries)

8. Domain d4luva1: 4luv A:1-120 [229646]
   Other proteins in same PDB: d4luva2
   automated match to d4ijha_
   protein/DNA complex; complexed with 1dz, 1xs

Details for d4luva1

PDB Entry: 4luv, 1.4 Å

PDB Description: Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein Interactions

PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d4luva1:

Sequence; same for both SEQRES and ATOM records:

>d4luva1 b.40.4.3 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne

Timeline for d4luva1:

• d4luva1 first appeared in SCOPe 2.03, called d4luva_
  
• d4luva1 appears in SCOPe 2.07