Lineage for d4lw1a1 (4lw1 A:1-120)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059459Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2059651Protein automated matches [190206] (9 species)
    not a true protein
  7. 2059664Species Human (Homo sapiens) [TaxId:9606] [186959] (26 PDB entries)
  8. 2059683Domain d4lw1a1: 4lw1 A:1-120 [229643]
    Other proteins in same PDB: d4lw1a2
    automated match to d4ijha_
    protein/DNA complex; complexed with 1xs

Details for d4lw1a1

PDB Entry: 4lw1 (more details), 1.63 Å

PDB Description: Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein Interactions
PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d4lw1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lw1a1 b.40.4.3 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne

SCOPe Domain Coordinates for d4lw1a1:

Click to download the PDB-style file with coordinates for d4lw1a1.
(The format of our PDB-style files is described here.)

Timeline for d4lw1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lw1a2