Lineage for d5azub_ (5azu B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Azurin [49530] (6 species) 
Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries) 
Domain d5azub_: 5azu B: [22964]
Details for d5azub_
PDB Entry: 5azu (more details), 1.9 Å
PDB Description: crystal structure analysis of oxidized pseudomonas aeruginosa azurin at ph 5.5 and ph 9.0. a ph-induced conformational transition involves a peptide bond flip
SCOP Domain Sequences for d5azub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5azub_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk
SCOP Domain Coordinates for d5azub_:
Click to download the PDB-style file with coordinates for d5azub_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5azub_:
- d5azub_ appears in SCOP 1.57
- d5azub_ appears in the current release, SCOPe 2.08
View in 3D
