Lineage for d4iwda1 (4iwd A:1048-1348)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219750Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2219751Species Human (Homo sapiens) [TaxId:9606] [103301] (52 PDB entries)
  8. 2219783Domain d4iwda1: 4iwd A:1048-1348 [229626]
    Other proteins in same PDB: d4iwda2, d4iwda3
    automated match to d3r7oa_
    complexed with 1jc

Details for d4iwda1

PDB Entry: 4iwd (more details), 1.99 Å

PDB Description: structure of dually phosphorylated c-met receptor kinase in complex with an mk-8033 analog
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d4iwda1:

Sequence, based on SEQRES records: (download)

>d4iwda1 d.144.1.7 (A:1048-1348) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
qntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihc
avkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrn
firnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglar
dmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdv
ntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfige
h

Sequence, based on observed residues (ATOM records): (download)

>d4iwda1 d.144.1.7 (A:1048-1348) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
qntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihc
avkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrn
firnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglar
dmydkeyysvhnklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfd
itvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigeh

SCOPe Domain Coordinates for d4iwda1:

Click to download the PDB-style file with coordinates for d4iwda1.
(The format of our PDB-style files is described here.)

Timeline for d4iwda1: