Lineage for d4ixua_ (4ixu A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850944Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1850945Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1850946Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 1850967Protein Arginase [52770] (5 species)
  7. 1851049Species Human (Homo sapiens), isoform II, mitochondrial [TaxId:9606] [102412] (7 PDB entries)
  8. 1851059Domain d4ixua_: 4ixu A: [229622]
    automated match to d1pq3a_
    complexed with 38i, ben, bme, mn

Details for d4ixua_

PDB Entry: 4ixu (more details), 1.9 Å

PDB Description: Crystal structure of human Arginase-2 complexed with inhibitor 11d: {(5R)-5-amino-5-carboxy-5-[(3-endo)-8-(3,4-dichlorobenzyl)-8-azabicyclo[3.2.1]oct-3-yl]pentyl}(trihydroxy)borate(1-)
PDB Compounds: (A:) Arginase-2, mitochondrial

SCOPe Domain Sequences for d4ixua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ixua_ c.42.1.1 (A:) Arginase {Human (Homo sapiens), isoform II, mitochondrial [TaxId: 9606]}
hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
gqtreg

SCOPe Domain Coordinates for d4ixua_:

Click to download the PDB-style file with coordinates for d4ixua_.
(The format of our PDB-style files is described here.)

Timeline for d4ixua_: