SCOPe 2.05: Domain d4imda_: 4imd A:

Lineage for d4imda_ (4imd A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (20 species)
   not a true protein

7. Species Pasteurella multocida [TaxId:1169409] [228765] (5 PDB entries)

8. Domain d4imda_: 4imd A: [229616]
   automated match to d4imdd_
   complexed with edo, po4

Details for d4imda_

PDB Entry: 4imd, 2.1 Å

PDB Description: Crystal Structure of Pasteurella multocida N-Acetyl-D-Neuraminic acid lyase trapped with pyruvate covalently bound through a Schiff base to Lys164

PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d4imda_:

Sequence; same for both SEQRES and ATOM records:

>d4imda_ c.1.10.1 (A:) automated matches {Pasteurella multocida [TaxId: 1169409]}
knlkgifsallvsfnadgsinekglrqivrynidkmkvdglyvggstgenfmlsteekke
ifriakdeakdeialiaqvgsvnlqeaielgkyatelgydslsavtpfyykfsfpeikhy
ydsiieatgnymivysipfltgvnigveqfgelyknpkvlgvxftagdfyllerlkkayp
nhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltqagklkealeiqhvtndl
iegilanglyltikellkldgveagycrepmtkelssekvafakelkakyls

Timeline for d4imda_:

• d4imda_ first appeared in SCOPe 2.03
  
• d4imda_ appears in SCOPe 2.04
  
• d4imda_ appears in SCOPe 2.06
  
• d4imda_ appears in the current release, SCOPe 2.08