SCOPe 2.06: Domain d4icka1: 4ick A:4-147

Lineage for d4icka1 (4ick A:4-147)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein automated matches [190465] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189707] (17 PDB entries)

8. Domain d4icka1: 4ick A:4-147 [229603]
   Other proteins in same PDB: d4icka2, d4ickb2
   automated match to d4ijxa_
   complexed with gol, mg, po4; mutant

Details for d4icka1

PDB Entry: 4ick, 2.1 Å

PDB Description: crystal structure of human ap4a hydrolase e58a mutant

PDB Compounds: (A:) Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]

SCOPe Domain Sequences for d4icka1:

Sequence; same for both SEQRES and ATOM records:

>d4icka1 d.113.1.1 (A:4-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
racgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalratqeea
gieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleeac
qlaqfkemkaalqeghqflcsiea

Timeline for d4icka1:

• d4icka1 first appeared in SCOPe 2.03, called d4icka_
  
• d4icka1 was called d4icka_ in SCOPe 2.05
  
• d4icka1 appears in SCOPe 2.07
  
• d4icka1 appears in the current release, SCOPe 2.08