| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.1: MutT-like [55812] (17 proteins) |
| Protein automated matches [190465] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189707] (13 PDB entries) |
| Domain d4icka1: 4ick A:4-147 [229603] Other proteins in same PDB: d4icka2, d4ickb2 automated match to d4ijxa_ complexed with gol, mg, po4; mutant |
PDB Entry: 4ick (more details), 2.1 Å
SCOPe Domain Sequences for d4icka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4icka1 d.113.1.1 (A:4-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
racgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalratqeea
gieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleeac
qlaqfkemkaalqeghqflcsiea
Timeline for d4icka1: