Lineage for d4ickb1 (4ick B:3-147)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2577869Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2578152Protein automated matches [190465] (6 species)
    not a true protein
  7. 2578169Species Human (Homo sapiens) [TaxId:9606] [189707] (27 PDB entries)
  8. 2578202Domain d4ickb1: 4ick B:3-147 [229602]
    Other proteins in same PDB: d4icka2, d4ickb2
    automated match to d4ijxb_
    complexed with gol, mg, po4; mutant

Details for d4ickb1

PDB Entry: 4ick (more details), 2.1 Å

PDB Description: crystal structure of human ap4a hydrolase e58a mutant
PDB Compounds: (B:) Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]

SCOPe Domain Sequences for d4ickb1:

Sequence, based on SEQRES records: (download)

>d4ickb1 d.113.1.1 (B:3-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalratqee
agieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleea
cqlaqfkemkaalqeghqflcsiea

Sequence, based on observed residues (ATOM records): (download)

>d4ickb1 d.113.1.1 (B:3-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lracgliifrrclipknaieflllqasdgihhwtppkghvepgeddletalratqeeagi
eagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleeacql
aqfkemkaalqeghqflcsiea

SCOPe Domain Coordinates for d4ickb1:

Click to download the PDB-style file with coordinates for d4ickb1.
(The format of our PDB-style files is described here.)

Timeline for d4ickb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ickb2