Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein automated matches [190465] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189707] (17 PDB entries) |
Domain d4ickb1: 4ick B:3-147 [229602] Other proteins in same PDB: d4icka2, d4ickb2 automated match to d4ijxb_ complexed with gol, mg, po4; mutant |
PDB Entry: 4ick (more details), 2.1 Å
SCOPe Domain Sequences for d4ickb1:
Sequence, based on SEQRES records: (download)
>d4ickb1 d.113.1.1 (B:3-147) automated matches {Human (Homo sapiens) [TaxId: 9606]} lracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalratqee agieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleea cqlaqfkemkaalqeghqflcsiea
>d4ickb1 d.113.1.1 (B:3-147) automated matches {Human (Homo sapiens) [TaxId: 9606]} lracgliifrrclipknaieflllqasdgihhwtppkghvepgeddletalratqeeagi eagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleeacql aqfkemkaalqeghqflcsiea
Timeline for d4ickb1: