Lineage for d4id8a_ (4id8 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2556327Family d.58.1.0: automated matches [229598] (1 protein)
    not a true family
  6. 2556328Protein automated matches [229599] (4 species)
    not a true protein
  7. 2556364Species Rhodopseudomonas palustris [TaxId:316058] [229600] (2 PDB entries)
  8. 2556365Domain d4id8a_: 4id8 A: [229601]
    automated match to d4dhva_
    complexed with f3s

Details for d4id8a_

PDB Entry: 4id8 (more details), 2.15 Å

PDB Description: The crystal structure of a [3Fe-4S] ferredoxin associated with CYP194A4 from R. palustris HaA2
PDB Compounds: (A:) Putative ferredoxin

SCOPe Domain Sequences for d4id8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4id8a_ d.58.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]}
ltihvdqdkcqgharckalapelfdlddygnahekgdgvvpadlidkawlaksncpenai
dited

SCOPe Domain Coordinates for d4id8a_:

Click to download the PDB-style file with coordinates for d4id8a_.
(The format of our PDB-style files is described here.)

Timeline for d4id8a_: