Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.0: automated matches [229598] (1 protein) not a true family |
Protein automated matches [229599] (2 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:316058] [229600] (2 PDB entries) |
Domain d4id8a_: 4id8 A: [229601] automated match to d4dhva_ complexed with f3s |
PDB Entry: 4id8 (more details), 2.15 Å
SCOPe Domain Sequences for d4id8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4id8a_ d.58.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]} ltihvdqdkcqgharckalapelfdlddygnahekgdgvvpadlidkawlaksncpenai dited
Timeline for d4id8a_: