Lineage for d1nzrb_ (1nzr B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162480Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
  4. 162481Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
  5. 162482Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 162500Protein Azurin [49530] (6 species)
  7. 162529Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries)
  8. 162585Domain d1nzrb_: 1nzr B: [22960]

Details for d1nzrb_

PDB Entry: 1nzr (more details), 2.2 Å

PDB Description: crystal structure of the azurin mutant nickel-trp48met from pseudomonas aeruginosa at 2.2 angstroms resolution
PDB Compounds: (B:)

SCOP Domain Sequences for d1nzrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzrb_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnmvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d1nzrb_:

Click to download the PDB-style file with coordinates for d1nzrb_.
(The format of our PDB-style files is described here.)

Timeline for d1nzrb_: