Lineage for d4ic0c_ (4ic0 C:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2243858Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2243859Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2243860Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2243977Protein Plasminogen activator inhibitor-1 [56587] (3 species)
  7. 2243978Species Human (Homo sapiens) [TaxId:9606] [56588] (15 PDB entries)
  8. 2243999Domain d4ic0c_: 4ic0 C: [229594]
    automated match to d1dvma_
    complexed with gde

Details for d4ic0c_

PDB Entry: 4ic0 (more details), 2.32 Å

PDB Description: Crystal Structure of PAI-1 in Complex with Gallate
PDB Compounds: (C:) Plasminogen activator inhibitor 1

SCOPe Domain Sequences for d4ic0c_:

Sequence, based on SEQRES records: (download)

>d4ic0c_ e.1.1.1 (C:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
psyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgf
kiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqv
dfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdsst
hrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyeke
vplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqa
dftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrh
nptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d4ic0c_ e.1.1.1 (C:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
psyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgf
kiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqv
dfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdsst
hrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyeke
vplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqa
dftslsdqeplhvalalqkvkievnesvivsarmapeeiiidrpflfvvrhnptgtvlfm
gqvmep

SCOPe Domain Coordinates for d4ic0c_:

Click to download the PDB-style file with coordinates for d4ic0c_.
(The format of our PDB-style files is described here.)

Timeline for d4ic0c_: