Lineage for d4iava_ (4iav A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142305Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2142478Family c.56.5.2: Carboxypeptidase T [53198] (1 protein)
    automatically mapped to Pfam PF00246
  6. 2142479Protein Carboxypeptidase T [53199] (1 species)
  7. 2142480Species Thermoactinomyces vulgaris [TaxId:2026] [53200] (12 PDB entries)
  8. 2142483Domain d4iava_: 4iav A: [229589]
    automated match to d4f8za_
    complexed with ca, cxa, gol, so4, zn; mutant

Details for d4iava_

PDB Entry: 4iav (more details), 1.35 Å

PDB Description: g215s, a251g, t257a, d260g, t262d mutant of carboxypeptidase t from thermoactinomyces vulgaris with n-sulfamoyl-l-phenylalanine
PDB Compounds: (A:) carboxypeptidase t

SCOPe Domain Sequences for d4iava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iava_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]}
dfpsydsgyhnynemvnkintvasnypnivkkfsigksyegrelwavkisdnvgtdenep
evlytalhharehltvemalytldlftqnynldsritnlvnnreiyivfninpdggeydi
ssgsykswrknrqpnsgssyvgtdlnrnygykwgccggssgspssetyrgrsafsapeta
amrdfinsrvvggkqqiktlitfhtyselilypysytytdvpsdmtqddfnvfktmantm
aqtngytpqqgsdlyiadggmddwaygqhkifaftfemyptsynpgfyppdevigretsr
nkeavlyvaekadcpysvigksc

SCOPe Domain Coordinates for d4iava_:

Click to download the PDB-style file with coordinates for d4iava_.
(The format of our PDB-style files is described here.)

Timeline for d4iava_: