Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.20: 3-hydroxyanthranilic acid dioxygenase-like [141618] (2 proteins) Pfam PF06052; 3-HAO |
Protein 3-hydroxyanthranilate-3,4-dioxygenase [141619] (2 species) |
Species Ralstonia metallidurans [TaxId:119219] [141620] (11 PDB entries) Uniprot Q1LCS4 1-174 |
Domain d4i3pa_: 4i3p A: [229587] automated match to d1yfua1 complexed with 1cw, fe2 |
PDB Entry: 4i3p (more details), 1.96 Å
SCOPe Domain Sequences for d4i3pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i3pa_ b.82.1.20 (A:) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} mltygapfnfprwidehahllkppvgnrqvwqdsdfivtvvggpnhrtdyhddpleeffy qlrgnaylnlwvdgrreradlkegdifllpphvrhspqrpeagsaclvierqrpagmldg fewycdacghlvhrvevqlksivtdlpplfesfyasedkrrcphcgqvhpgraa
Timeline for d4i3pa_: