Lineage for d4hi9a_ (4hi9 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944478Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1944479Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1944620Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. 1944621Protein automated matches [191267] (5 species)
    not a true protein
  7. 1944634Species Human (Homo sapiens) [TaxId:9606] [189837] (18 PDB entries)
  8. 1944636Domain d4hi9a_: 4hi9 A: [229586]
    automated match to d4f6rd_
    complexed with iod, po4, zn

Details for d4hi9a_

PDB Entry: 4hi9 (more details), 1.2 Å

PDB Description: 1.2 structure of integrin-linked kinase ankyrin repeat domain in complex with pinch1 lim1 domain collected at wavelength 0.91974
PDB Compounds: (A:) Integrin-linked protein kinase

SCOPe Domain Sequences for d4hi9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hi9a_ d.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diftqcregnavavrlwldntendlnqgddhgfsplhwacregrsavvemlimrgarinv
mnrgddtplhlaashghrdivqkllqykadinavnehgnvplhyacfwgqdqvaedlvan
galvsicnkygempvdkakaplrellreraekmgqnlnripykdtfwk

SCOPe Domain Coordinates for d4hi9a_:

Click to download the PDB-style file with coordinates for d4hi9a_.
(The format of our PDB-style files is described here.)

Timeline for d4hi9a_: