Lineage for d4fzoa1 (4fzo A:2-77)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697332Superfamily a.8.11: AF1782-like [158372] (1 family) (S)
    automatically mapped to Pfam PF04010
  5. 2697333Family a.8.11.1: AF1782-like [158373] (3 proteins)
    Pfam PF04010; DUF357
  6. 2697340Protein automated matches [229582] (1 species)
    not a true protein
  7. 2697341Species Methanothermobacter thermautotrophicus [TaxId:187420] [229583] (2 PDB entries)
  8. 2697342Domain d4fzoa1: 4fzo A:2-77 [229585]
    Other proteins in same PDB: d4fzoa2, d4fzoa3, d4fzob2, d4fzob3
    automated match to d2pmra1

Details for d4fzoa1

PDB Entry: 4fzo (more details), 1.3 Å

PDB Description: Crystal Structure of the apo-form uranyl binding protein
PDB Compounds: (A:) uranyl binding protein

SCOPe Domain Sequences for d4fzoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fzoa1 a.8.11.1 (A:2-77) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dcreriekdledlekelmemksiklsddeeavveralnyrddsvyylekgdhitsfgcit
yaegltdslrmlhrii

SCOPe Domain Coordinates for d4fzoa1:

Click to download the PDB-style file with coordinates for d4fzoa1.
(The format of our PDB-style files is described here.)

Timeline for d4fzoa1: