SCOPe 2.06: Domain d4fzob1: 4fzo B:2-77

Lineage for d4fzob1 (4fzo B:2-77)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.11: AF1782-like [158372] (1 family)
   automatically mapped to Pfam PF04010

5. Family a.8.11.1: AF1782-like [158373] (3 proteins)
   Pfam PF04010; DUF357

6. Protein automated matches [229582] (1 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [229583] (2 PDB entries)

8. Domain d4fzob1: 4fzo B:2-77 [229584]
   Other proteins in same PDB: d4fzoa2, d4fzoa3, d4fzob2, d4fzob3
   automated match to d2pmra1

Details for d4fzob1

PDB Entry: 4fzo, 1.3 Å

PDB Description: Crystal Structure of the apo-form uranyl binding protein

PDB Compounds: (B:) uranyl binding protein

SCOPe Domain Sequences for d4fzob1:

Sequence; same for both SEQRES and ATOM records:

>d4fzob1 a.8.11.1 (B:2-77) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dcreriekdledlekelmemksiklsddeeavveralnyrddsvyylekgdhitsfgcit
yaegltdslrmlhrii

Timeline for d4fzob1:

• d4fzob1 first appeared in SCOPe 2.03, called d4fzob_
  
• d4fzob1 was called d4fzob_ in SCOPe 2.05
  
• d4fzob1 appears in SCOPe 2.07
  
• d4fzob1 appears in the current release, SCOPe 2.08