Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mus musculus [TaxId:10090] [227304] (35 PDB entries) |
Domain d4cada2: 4cad A:108-212 [229581] automated match to d4cadg2 complexed with bog, lmt |
PDB Entry: 4cad (more details), 2.5 Å
SCOPe Domain Sequences for d4cada2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cada2 b.1.1.0 (A:108-212) automated matches {Mus musculus [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d4cada2:
View in 3D Domains from other chains: (mouse over for more information) d4cadd1, d4cadd2, d4cadj1, d4cadj2 |