| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) Pfam PF00665 |
| Protein automated matches [190209] (5 species) not a true protein |
| Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries) |
| Domain d4cf8a_: 4cf8 A: [229570] automated match to d4ah9a_ complexed with acy, cl, edo, gol, so4, v7h |
PDB Entry: 4cf8 (more details), 1.65 Å
SCOPe Domain Sequences for d4cf8a_:
Sequence, based on SEQRES records: (download)
>d4cf8a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq
>d4cf8a_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkgysagerivdiiatdiq
Timeline for d4cf8a_: