Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
Protein Angiotensin converting enzyme, ACE [82733] (2 species) M2 family member; overall fold is similar to that of neurolysin but is less elaborated |
Species Human (Homo sapiens) [TaxId:9606] [82734] (11 PDB entries) Uniprot P22966 |
Domain d4ca5a_: 4ca5 A: [229564] automated match to d1uzea_ complexed with 3ef, act, cl, nag, peg, zn |
PDB Entry: 4ca5 (more details), 1.85 Å
SCOPe Domain Sequences for d4ca5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ca5a_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]} deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnks mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv alreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkiafip fsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvp yiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamq litgqpnmsasamlsyfkplldwlrtenelhgeklgwpqynwtpns
Timeline for d4ca5a_: