| Class b: All beta proteins [48724] (180 folds) |
| Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
| Family b.8.1.2: SIAH, seven in absentia homolog [69198] (2 proteins) automatically mapped to Pfam PF03145 |
| Protein automated matches [190456] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187371] (5 PDB entries) |
| Domain d4c9zb_: 4c9z B: [229560] Other proteins in same PDB: d4c9za2 automated match to d4c9za_ complexed with cl, gol, so4, trs, zn |
PDB Entry: 4c9z (more details), 1.95 Å
SCOPe Domain Sequences for d4c9zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c9zb_ b.8.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lfpckyassgceitlphtekadheelcefrpyscpcpgasckwqgsldavmphlmhqhks
ittlqgedivflatdinlpgavdwvmmqscfgfhfmlvlekqekydghqqffaivqligt
rkqaenfayrlelnghrrrltweatprsihegiataimnsdclvfdtsiaqlfaengnlg
invtismc
Timeline for d4c9zb_: