Lineage for d1ilsb_ (1ils B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 55934Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 55952Protein Azurin [49530] (6 species)
  7. 55981Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries)
  8. 56017Domain d1ilsb_: 1ils B: [22956]

Details for d1ilsb_

PDB Entry: 1ils (more details), 2.2 Å

PDB Description: x-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa

SCOP Domain Sequences for d1ilsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ilsb_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa}
aecsvdsqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d1ilsb_:

Click to download the PDB-style file with coordinates for d1ilsb_.
(The format of our PDB-style files is described here.)

Timeline for d1ilsb_: