Lineage for d4c6xa1 (4c6x A:2-259)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917965Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries)
  8. 2917998Domain d4c6xa1: 4c6x A:2-259 [229555]
    automated match to d4c6wa1
    complexed with edo, epe, k, m7u, tlm

Details for d4c6xa1

PDB Entry: 4c6x (more details), 1.95 Å

PDB Description: Crystal structure of M. tuberculosis C171Q KasA in complex with thiolactomycin (TLM)
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d4c6xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c6xa1 c.95.1.0 (A:2-259) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
agalmlieteehakarga

SCOPe Domain Coordinates for d4c6xa1:

Click to download the PDB-style file with coordinates for d4c6xa1.
(The format of our PDB-style files is described here.)

Timeline for d4c6xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c6xa2