SCOP 1.59: Domain d4azud_: 4azu D:

Lineage for d4azud_ (4azu D:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (4 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (31 PDB entries)

8. Domain d4azud_: 4azu D: [22954]

Details for d4azud_

PDB Entry: 4azu, 1.9 Å

PDB Description: crystal structure analysis of oxidized pseudomonas aeruginosa azurin at ph 5.5 and ph 9.0. a ph-induced conformational transition involves a peptide bond flip

SCOP Domain Sequences for d4azud_:

Sequence; same for both SEQRES and ATOM records:

>d4azud_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Timeline for d4azud_:

• d4azud_ first appeared (with stable ids) in SCOP 1.55
  
• d4azud_ appears in SCOP 1.57
  
• d4azud_ appears in SCOP 1.61
  
• d4azud_ appears in the current release, SCOPe 2.08