SCOPe 2.04: Domain d4c6wb1: 4c6w B:2-259

Lineage for d4c6wb1 (4c6w B:2-259)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (45 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [228163] (12 PDB entries)

8. Domain d4c6wb1: 4c6w B:2-259 [229537]
   automated match to d4c6wa1
   complexed with epe, k, m7u, na, peg

Details for d4c6wb1

PDB Entry: 4c6w, 1.7 Å

PDB Description: Crystal structure of M. tuberculosis C171Q KasA

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d4c6wb1:

Sequence; same for both SEQRES and ATOM records:

>d4c6wb1 c.95.1.0 (B:2-259) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sqpstanggfpsvvvtavtattsispdiestwkgllagesgihaledefvtkwdlavkig
ghlkdpvdshmgrldmrrmsyvqrmgkllggqlwesagspevdpdrfavvvgtglggaer
ivesydlmnaggprkvsplavqmimpngaaaviglqlgaragvmtpvsaqssgseaiaha
wrqivmgdadvavcggvegpiealpiaafsmmramstrndeperasrpfdkdrdgfvfge
agalmlieteehakarga

Timeline for d4c6wb1:

• d4c6wb1 first appeared in SCOPe 2.03
  
• d4c6wb1 appears in SCOPe 2.05
  
• d4c6wb1 appears in the current release, SCOPe 2.08