Lineage for d4azuc_ (4azu C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043108Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2043186Protein Azurin [49530] (6 species)
  7. 2043217Species Pseudomonas aeruginosa [TaxId:287] [49533] (90 PDB entries)
    Uniprot P00282
  8. 2043344Domain d4azuc_: 4azu C: [22953]
    complexed with cu, no3

Details for d4azuc_

PDB Entry: 4azu (more details), 1.9 Å

PDB Description: crystal structure analysis of oxidized pseudomonas aeruginosa azurin at ph 5.5 and ph 9.0. a ph-induced conformational transition involves a peptide bond flip
PDB Compounds: (C:) Azurin

SCOPe Domain Sequences for d4azuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4azuc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOPe Domain Coordinates for d4azuc_:

Click to download the PDB-style file with coordinates for d4azuc_.
(The format of our PDB-style files is described here.)

Timeline for d4azuc_: