SCOP 1.61: Domain d4azuc_: 4azu C:

Lineage for d4azuc_ (4azu C:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries)

8. Domain d4azuc_: 4azu C: [22953]

Details for d4azuc_

PDB Entry: 4azu, 1.9 Å

PDB Description: crystal structure analysis of oxidized pseudomonas aeruginosa azurin at ph 5.5 and ph 9.0. a ph-induced conformational transition involves a peptide bond flip

SCOP Domain Sequences for d4azuc_:

Sequence; same for both SEQRES and ATOM records:

>d4azuc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Timeline for d4azuc_:

• d4azuc_ first appeared (with stable ids) in SCOP 1.55
  
• d4azuc_ appears in SCOP 1.59
  
• d4azuc_ appears in SCOP 1.63
  
• d4azuc_ appears in the current release, SCOPe 2.08