Lineage for d4c20a1 (4c20 A:2-353)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910317Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
    consists of two domains of similar topology, 3 layers (a/b/a) each
    Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
    Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134
  4. 2910318Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) (S)
  5. 2910356Family c.85.1.0: automated matches [227251] (1 protein)
    not a true family
  6. 2910357Protein automated matches [227031] (3 species)
    not a true protein
  7. 2910387Species Streptococcus pneumoniae [TaxId:170187] [229523] (3 PDB entries)
  8. 2910388Domain d4c20a1: 4c20 A:2-353 [229529]
    Other proteins in same PDB: d4c20a2, d4c20b2, d4c20b3
    automated match to d1fuia2
    complexed with edo, mn, so4, trs

Details for d4c20a1

PDB Entry: 4c20 (more details), 2.41 Å

PDB Description: L-Fucose Isomerase
PDB Compounds: (A:) l-fucose isomerase

SCOPe Domain Sequences for d4c20a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c20a1 c.85.1.0 (A:2-353) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
iqhprigirptidgrrqgvreslevqtmnmaksvadlisstlkypdgepvecvispstig
rvpeaaashelfkksnvcatitvtpcwcygsetmdmspdiphaiwgfngterpgavylaa
vlashaqkgipafgiygrdvqeasdtdipedvkekllryaraalatglmrdtaylsmgsv
smgiggsivnpdffqeylgmrnesvdmteftrrmdrgiydpeeferalkwvkenvkegfd
hnredlvlsreekdrqwefvikmfmigrdlmvgnprlaelgfeeeavghhalvagfqgqr
qwtdhfpngdfmetflntqfdwngirkpfvfatendslngvsmlfnylltnt

SCOPe Domain Coordinates for d4c20a1:

Click to download the PDB-style file with coordinates for d4c20a1.
(The format of our PDB-style files is described here.)

Timeline for d4c20a1: