![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily) consists of two domains of similar topology, 3 layers (a/b/a) each Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345 Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) ![]() |
![]() | Family c.85.1.0: automated matches [227251] (1 protein) not a true family |
![]() | Protein automated matches [227031] (3 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:170187] [229523] (3 PDB entries) |
![]() | Domain d4c20a1: 4c20 A:2-353 [229529] Other proteins in same PDB: d4c20a2, d4c20b2, d4c20b3 automated match to d1fuia2 complexed with edo, mn, so4, trs |
PDB Entry: 4c20 (more details), 2.41 Å
SCOPe Domain Sequences for d4c20a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c20a1 c.85.1.0 (A:2-353) automated matches {Streptococcus pneumoniae [TaxId: 170187]} iqhprigirptidgrrqgvreslevqtmnmaksvadlisstlkypdgepvecvispstig rvpeaaashelfkksnvcatitvtpcwcygsetmdmspdiphaiwgfngterpgavylaa vlashaqkgipafgiygrdvqeasdtdipedvkekllryaraalatglmrdtaylsmgsv smgiggsivnpdffqeylgmrnesvdmteftrrmdrgiydpeeferalkwvkenvkegfd hnredlvlsreekdrqwefvikmfmigrdlmvgnprlaelgfeeeavghhalvagfqgqr qwtdhfpngdfmetflntqfdwngirkpfvfatendslngvsmlfnylltnt
Timeline for d4c20a1: