SCOPe 2.08: Domain d4c22a1: 4c22 A:2-353

Lineage for d4c22a1 (4c22 A:2-353)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
   consists of two domains of similar topology, 3 layers (a/b/a) each
   Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
   Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families)

5. Family c.85.1.0: automated matches [227251] (1 protein)
   not a true family

6. Protein automated matches [227031] (3 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [229523] (3 PDB entries)

8. Domain d4c22a1: 4c22 A:2-353 [229527]
   Other proteins in same PDB: d4c22a2, d4c22b2, d4c22b3
   automated match to d1fuia2
   complexed with cvu, edo, fuc, mn

Details for d4c22a1

PDB Entry: 4c22, 2.7 Å

PDB Description: l-fucose isomerase in complex with fuculose

PDB Compounds: (A:) l-fucose isomerase

SCOPe Domain Sequences for d4c22a1:

Sequence; same for both SEQRES and ATOM records:

>d4c22a1 c.85.1.0 (A:2-353) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
iqhprigirptidgrrqgvreslevqtmnmaksvadlisstlkypdgepvecvispstig
rvpeaaashelfkksnvcatitvtpcwcygsetmdmspdiphaiwgfngterpgavylaa
vlashaqkgipafgiygrdvqeasdtdipedvkekllryaraalatglmrdtaylsmgsv
smgiggsivnpdffqeylgmrnesvdmteftrrmdrgiydpeeferalkwvkenvkegfd
hnredlvlsreekdrqwefvikmfmigrdlmvgnprlaelgfeeeavghhalvagfqgqr
qwtdhfpngdfmetflntqfdwngirkpfvfatendslngvsmlfnylltnt

Timeline for d4c22a1:

• d4c22a1 first appeared in SCOPe 2.03
  
• d4c22a1 appears in SCOPe 2.07