![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
![]() | Protein automated matches [190340] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187164] (8 PDB entries) |
![]() | Domain d4c2oa_: 4c2o A: [229522] automated match to d3bkka_ complexed with act, cl, mla, nag, pe4, so4, zn; mutant |
PDB Entry: 4c2o (more details), 1.8 Å
SCOPe Domain Sequences for d4c2oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2oa_ d.92.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnks mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv alreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkiafip fsylvtqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvp yiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamq litgqpnmsasamlsyfkplldwlrtenelhgeklgwpqynwtpns
Timeline for d4c2oa_: