Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
Protein automated matches [190340] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187164] (12 PDB entries) |
Domain d4c2qa_: 4c2q A: [229521] automated match to d3bkka_ complexed with act, cl, pe4, so4, zn; mutant |
PDB Entry: 4c2q (more details), 2.4 Å
SCOPe Domain Sequences for d4c2qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2qa_ d.92.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} deaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqa rkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngscl qlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagds wrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmw aqtwsniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnks mlekptdgrevvchasawdfyngkdfrikqcttvnledlvvahhemghiqyfmqykdlpv alreganpgfheaigdvlalsvstpkhlhslnllsseggsdehdinflmkmaldkiafip fsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssvp yikyfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamq litgqpnmsasamlsyfkplldwlrtenelhgeklgwpqynwtpns
Timeline for d4c2qa_: