SCOPe 2.07: Domain d4c24a1: 4c24 A:2-206

Lineage for d4c24a1 (4c24 A:2-206)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
   3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5

4. Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families)

5. Family c.74.1.0: automated matches [227217] (1 protein)
   not a true family

6. Protein automated matches [226955] (2 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [229518] (2 PDB entries)

8. Domain d4c24a1: 4c24 A:2-206 [229519]
   Other proteins in same PDB: d4c24a2
   automated match to d2fuaa_
   complexed with edo, gol, ni, so4, zn

Details for d4c24a1

PDB Entry: 4c24, 1.5 Å

PDB Description: L-fuculose 1-phosphate aldolase

PDB Compounds: (A:) l-fuculose phosphate aldolase

SCOPe Domain Sequences for d4c24a1:

Sequence; same for both SEQRES and ATOM records:

>d4c24a1 c.74.1.0 (A:2-206) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
sdvkqelikygkklvetdltkgtggnlsvfdrekqlmaitpsgidffeikesdivvmdin
gnvvegerlpssewymhliqyqtrddidaiihahttyatvlaclreplpashymiavagk
dvrvaeyatygtkelavnaakamegrravllanhgilagaqnllnafniveeveycakiy
claknfgepvvlpdeemelmaekfk

Timeline for d4c24a1:

• d4c24a1 first appeared in SCOPe 2.03, called d4c24a_
  
• d4c24a1 appears in SCOPe 2.06