Lineage for d4c24a1 (4c24 A:2-206)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905490Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2905491Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2905593Family c.74.1.0: automated matches [227217] (1 protein)
    not a true family
  6. 2905594Protein automated matches [226955] (4 species)
    not a true protein
  7. 2905603Species Streptococcus pneumoniae [TaxId:170187] [229518] (2 PDB entries)
  8. 2905604Domain d4c24a1: 4c24 A:2-206 [229519]
    Other proteins in same PDB: d4c24a2
    automated match to d2fuaa_
    complexed with edo, gol, ni, so4, zn

Details for d4c24a1

PDB Entry: 4c24 (more details), 1.5 Å

PDB Description: L-fuculose 1-phosphate aldolase
PDB Compounds: (A:) l-fuculose phosphate aldolase

SCOPe Domain Sequences for d4c24a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c24a1 c.74.1.0 (A:2-206) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
sdvkqelikygkklvetdltkgtggnlsvfdrekqlmaitpsgidffeikesdivvmdin
gnvvegerlpssewymhliqyqtrddidaiihahttyatvlaclreplpashymiavagk
dvrvaeyatygtkelavnaakamegrravllanhgilagaqnllnafniveeveycakiy
claknfgepvvlpdeemelmaekfk

SCOPe Domain Coordinates for d4c24a1:

Click to download the PDB-style file with coordinates for d4c24a1.
(The format of our PDB-style files is described here.)

Timeline for d4c24a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4c24a2