![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily) 3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5 |
![]() | Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) ![]() |
![]() | Family c.74.1.0: automated matches [227217] (1 protein) not a true family |
![]() | Protein automated matches [226955] (4 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:170187] [229518] (2 PDB entries) |
![]() | Domain d4c24a1: 4c24 A:2-206 [229519] Other proteins in same PDB: d4c24a2 automated match to d2fuaa_ complexed with edo, gol, ni, so4, zn |
PDB Entry: 4c24 (more details), 1.5 Å
SCOPe Domain Sequences for d4c24a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c24a1 c.74.1.0 (A:2-206) automated matches {Streptococcus pneumoniae [TaxId: 170187]} sdvkqelikygkklvetdltkgtggnlsvfdrekqlmaitpsgidffeikesdivvmdin gnvvegerlpssewymhliqyqtrddidaiihahttyatvlaclreplpashymiavagk dvrvaeyatygtkelavnaakamegrravllanhgilagaqnllnafniveeveycakiy claknfgepvvlpdeemelmaekfk
Timeline for d4c24a1: