SCOPe 2.08: Domain d4gw1c2: 4gw1 C:108-213

Lineage for d4gw1c2 (4gw1 C:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Murinae, homo sapiens [TaxId:39107] [228176] (2 PDB entries)

8. Domain d4gw1c2: 4gw1 C:108-213 [229501]
   Other proteins in same PDB: d4gw1a1, d4gw1b_, d4gw1c1, d4gw1d_
   automated match to d1g9ml2
   complexed with po4

Details for d4gw1c2

PDB Entry: 4gw1, 2.24 Å

PDB Description: cqfd meditope

PDB Compounds: (C:) Fab light chain

SCOPe Domain Sequences for d4gw1c2:

Sequence; same for both SEQRES and ATOM records:

>d4gw1c2 b.1.1.2 (C:108-213) automated matches {Murinae, homo sapiens [TaxId: 39107]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4gw1c2:

• d4gw1c2 first appeared in SCOPe 2.03
  
• d4gw1c2 appears in SCOPe 2.07