SCOPe 2.06: Domain d1e67d_: 1e67 D:

Lineage for d1e67d_ (1e67 D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (90 PDB entries)
   Uniprot P00282

8. Domain d1e67d_: 1e67 D: [22950]
   complexed with no3, zn

Details for d1e67d_

PDB Entry: 1e67, 2.14 Å

PDB Description: zn-azurin from pseudomonas aeruginosa

PDB Compounds: (D:) Azurin

SCOPe Domain Sequences for d1e67d_:

Sequence; same for both SEQRES and ATOM records:

>d1e67d_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Timeline for d1e67d_:

• d1e67d_ first appeared (with stable ids) in SCOP 1.55
  
• d1e67d_ appears in SCOPe 2.05
  
• d1e67d_ appears in SCOPe 2.07
  
• d1e67d_ appears in the current release, SCOPe 2.08