SCOPe 2.03: Domain d4mdna_: 4mdn A:

Lineage for d4mdna_ (4mdn A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (36 PDB entries)

8. Domain d4mdna_: 4mdn A: [229496]
   automated match to d3lbla_
   complexed with so4, y30

Details for d4mdna_

PDB Entry: 4mdn, 1.91 Å

PDB Description: Structure of a novel submicromolar MDM2 inhibitor

PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4mdna_:

Sequence; same for both SEQRES and ATOM records:

>d4mdna_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
csndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Timeline for d4mdna_:

• d4mdna_ is new in SCOPe 2.03-stable
  
• d4mdna_ appears in SCOPe 2.04
  
• d4mdna_ appears in the current release, SCOPe 2.08, called d4mdna1