Class a: All alpha proteins [46456] (284 folds) |
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) binds to the transactivation domain of human p53 |
Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins) Pfam PF02201 |
Protein MDM2 [47594] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47596] (36 PDB entries) |
Domain d4mdna_: 4mdn A: [229496] automated match to d3lbla_ complexed with so4, y30 |
PDB Entry: 4mdn (more details), 1.91 Å
SCOPe Domain Sequences for d4mdna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mdna_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]} mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy csndllgdlfgvpsfsvkehrkiytmiyrnlvvv
Timeline for d4mdna_: