| Class b: All beta proteins [48724] (180 folds) |
| Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) ![]() |
| Family b.15.1.1: HSP20 [49765] (2 proteins) |
| Protein Small heat shock protein [49766] (2 species) |
| Species Methanococcus jannaschii [TaxId:2190] [49767] (3 PDB entries) |
| Domain d4i88b_: 4i88 B: [229495] automated match to d1shsa_ |
PDB Entry: 4i88 (more details), 2.85 Å
SCOPe Domain Sequences for d4i88b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i88b_ b.15.1.1 (B:) Small heat shock protein {Methanococcus jannaschii [TaxId: 2190]}
giqisgkgfmpisiiegdqhikviawlpgvnkediilnavgdtleirakrsplmiteser
iiyseipeeeeiyrtiklpatvkeenasakfengvlsvilpkaessikkginie
Timeline for d4i88b_: