![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily) core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest |
![]() | Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) ![]() |
![]() | Family c.76.1.5: DeoB catalytic domain-like [142735] (1 protein) Pfam PF08342 in the N-terminal part; Pfam PF01676 in the C-terminal part; there is an alpha+beta domain between the two parts, inserted in the same location as the substrate-binding domain of 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase |
![]() | Protein Phosphopentomutase DeoB [142736] (1 species) |
![]() | Species Streptococcus mutans [TaxId:1309] [142737] (2 PDB entries) Uniprot Q8DTU0 2-107,227-403 |
![]() | Domain d4n7ta1: 4n7t A:2-107,A:227-403 [229492] Other proteins in same PDB: d4n7ta2, d4n7tb2 automated match to d3m7va1 complexed with azi, gol, mn, peg, so4 |
PDB Entry: 4n7t (more details), 2 Å
SCOPe Domain Sequences for d4n7ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n7ta1 c.76.1.5 (A:2-107,A:227-403) Phosphopentomutase DeoB {Streptococcus mutans [TaxId: 1309]} stfnrihlvvldsvgigaapdannfsnagvpdgasdtlghisktvglnvpnmakiglgni prdtplktvpaenhptgyvtkleevslgkdtmtghweimglnitepXspfaptvlnklad agvstyavgkindifngsgitndmghnksnshgvdtliktmglsaftkgfsftnlvdfda lyghrrnahgyrdclhefderlpeiiaamkvddlllitadhgndptyagtdhtreyvpll ayspsftgngvlpvghyadisatiadnfgvdtamigesfldkli
Timeline for d4n7ta1: