Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d4jfxa2: 4jfx A:108-214 [229491] Other proteins in same PDB: d4jfxa1, d4jfxl1 automated match to d4jfzl2 complexed with pg4 |
PDB Entry: 4jfx (more details), 1.95 Å
SCOPe Domain Sequences for d4jfxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jfxa2 b.1.1.2 (A:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d4jfxa2: