SCOPe 2.08: Domain d4jfxa2: 4jfx A:108-214

Lineage for d4jfxa2 (4jfx A:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4jfxa2: 4jfx A:108-214 [229491]
   Other proteins in same PDB: d4jfxa1, d4jfxb_, d4jfxh_, d4jfxl1
   automated match to d4jfzl2
   complexed with pg4

Details for d4jfxa2

PDB Entry: 4jfx, 1.95 Å

PDB Description: structure of phosphotyrosine (ptyr) scaffold bound to ptyr peptide

PDB Compounds: (A:) Fab light chain

SCOPe Domain Sequences for d4jfxa2:

Sequence; same for both SEQRES and ATOM records:

>d4jfxa2 b.1.1.2 (A:108-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4jfxa2:

• d4jfxa2 first appeared in SCOPe 2.03
  
• d4jfxa2 appears in SCOPe 2.07