SCOPe 2.08: Domain d4l8sa2: 4l8s A:111-200

Lineage for d4l8sa2 (4l8s A:111-200)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4l8sa2: 4l8s A:111-200 [229489]
   Other proteins in same PDB: d4l8sa1, d4l8sb1, d4l8sb2
   automated match to d2f54d2
   complexed with so4

Details for d4l8sa2

PDB Entry: 4l8s, 2.9 Å

PDB Description: crystal structure of a human valpha7.2/vbeta13.3 mait tcr in complex with bovine mr1

PDB Compounds: (A:) Muccosal Associated Invariant T Cell Receptor alpha chain

SCOPe Domain Sequences for d4l8sa2:

Sequence; same for both SEQRES and ATOM records:

>d4l8sa2 b.1.1.2 (A:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Timeline for d4l8sa2:

• d4l8sa2 first appeared in SCOPe 2.03
  
• d4l8sa2 appears in SCOPe 2.07