SCOPe 2.08: Domain d4l8sa1: 4l8s A:3-110

Lineage for d4l8sa1 (4l8s A:3-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4l8sa1: 4l8s A:3-110 [229488]
   Other proteins in same PDB: d4l8sa2
   automated match to d2f54d1
   complexed with so4

Details for d4l8sa1

PDB Entry: 4l8s, 2.9 Å

PDB Description: crystal structure of a human valpha7.2/vbeta13.3 mait tcr in complex with bovine mr1

PDB Compounds: (A:) Muccosal Associated Invariant T Cell Receptor alpha chain

SCOPe Domain Sequences for d4l8sa1:

Sequence; same for both SEQRES and ATOM records:

>d4l8sa1 b.1.1.0 (A:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfss
flsrskgysylllkelqmkdsasylcasmdsnyqliwgagtkliikpn

Timeline for d4l8sa1:

• d4l8sa1 first appeared in SCOPe 2.03
  
• d4l8sa1 appears in SCOPe 2.07