Lineage for d4i9la2 (4i9l A:376-903)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016466Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3016563Protein Family B DNA polymerase [56680] (7 species)
  7. 3016564Species Bacteriophage RB69 [TaxId:12353] [56681] (93 PDB entries)
  8. 3016648Domain d4i9la2: 4i9l A:376-903 [229485]
    Other proteins in same PDB: d4i9la1
    automated match to d1ih7a2
    complexed with cl, gmp, so4; mutant

Details for d4i9la2

PDB Entry: 4i9l (more details), 2.6 Å

PDB Description: Crystal structure of the D714A mutant of RB69 DNA polymerase
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4i9la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i9la2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwamegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

SCOPe Domain Coordinates for d4i9la2:

Click to download the PDB-style file with coordinates for d4i9la2.
(The format of our PDB-style files is described here.)

Timeline for d4i9la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i9la1