Lineage for d4jega_ (4jeg A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1424633Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1424634Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1425059Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1425060Protein automated matches [190561] (2 species)
    not a true protein
  7. 1425061Species Human (Homo sapiens) [TaxId:9606] [187549] (7 PDB entries)
  8. 1425066Domain d4jega_: 4jeg A: [229481]
    automated match to d2fcia1

Details for d4jega_

PDB Entry: 4jeg (more details), 2.3 Å

PDB Description: crystal structure of monobody cs1/shp2 c-sh2 domain complex
PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4jega_:

Sequence, based on SEQRES records: (download)

>d4jega_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lncadptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesn
dgkskvthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnke

Sequence, based on observed residues (ATOM records): (download)

>d4jega_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lncadptserwfhghlsgkeaeklltekgkhgsflvresqshpgdfvlsvrtgddkdgks
kvthvmircqelkydvgggerfdsltdlvehykknpmvetlgtvlqlkqplnke

SCOPe Domain Coordinates for d4jega_:

Click to download the PDB-style file with coordinates for d4jega_.
(The format of our PDB-style files is described here.)

Timeline for d4jega_: