Lineage for d3wk2a_ (3wk2 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1337250Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1337330Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1337470Protein automated matches [190130] (11 species)
    not a true protein
  7. 1337517Species Methanothermobacter thermautotrophicus [TaxId:145262] [189782] (26 PDB entries)
  8. 1337560Domain d3wk2a_: 3wk2 A: [229474]
    automated match to d2zz2a_
    complexed with gol, o7m; mutant

Details for d3wk2a_

PDB Entry: 3wk2 (more details), 1.69 Å

PDB Description: Orotidine 5'-monophosphate decarboxylase K72A mutant from M. thermoautotrophicus complexed with orotidine 5'-monophosphate methyl ester
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3wk2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wk2a_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
favadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesikdl

SCOPe Domain Coordinates for d3wk2a_:

Click to download the PDB-style file with coordinates for d3wk2a_.
(The format of our PDB-style files is described here.)

Timeline for d3wk2a_: